DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf7 and kay

DIOPT Version :9

Sequence 1:NP_001101585.1 Gene:Atf7 / 315333 RGDID:1304940 Length:485 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:397 Identity:89/397 - (22%)
Similarity:146/397 - (36%) Gaps:108/397 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat   170 TLPSPTSVITQAPPSNRQIGSPTGSLPLVMHLANGQTMPMLPGPPVQMPSVISLARPVSMVPNIP 234
            ||.:|    |..|.:.|.|....|.|     |::.||..:.......:|.|:..|..| :...||
  Fly   246 TLTTP----TLTPTTTRNIEDTLGHL-----LSDTQTDRVAGCAGFAVPKVLPNAIDV-LGMGIP 300

  Rat   235 -GIPGPPVNNS-------GSISPSGHPMPSEAKMRLKATLTHQVS----------------SING 275
             |:...|:..:       ||.|...:...::.:|..:...|...|                |:||
  Fly   301 TGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNG 365

  Rat   276 G-----CGMVVGTASTMVTARPEQNQILIQHPDAPSPAQPQVSPAQPTPSTGGRR-RRTVDEDPD 334
            |     ..::...:|:..:|..           ..|.|....:||:   ..|||| .|:.:..|:
  Fly   366 GGVNNFSNVLAAVSSSRGSASV-----------GSSNANTSNTPAR---RGGGRRPNRSTNMTPE 416

  Rat   335 ERRQRFL--ERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAH 397
            |.::|.:  |||:.||:|||::|....:.|.::.|:|..:...:..|:.:|.|...||:.||..|
  Fly   417 EEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATH 481

  Rat   398 K--------------DC-----PVTALQKKTQGYLESPKESSEPTGSPAPVIQHSSATAPSNG-- 441
            :              .|     |...|...:.|...|...:.....|....|....||..|.|  
  Fly   482 RATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRS 546

  Rat   442 ---LSVRSAAEAVATSVLTQMASQRTE-------------------LSMPIQS---HV----IMT 477
               |.::.||.  ..|:|..:..:..:                   :::|..|   ||    |:|
  Fly   547 NSPLDLKPAAN--IDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILT 609

  Rat   478 PQSQSAG 484
            |...|:|
  Fly   610 PTGASSG 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf7NP_001101585.1 C2H2 Zn finger 9..31 CDD:275368
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 336..396 CDD:269835 20/61 (33%)
coiled coil 336..396 CDD:269835 20/61 (33%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 20/60 (33%)
coiled coil 421..480 CDD:269869 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.