DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and Cgas

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_038938458.1 Gene:Cgas / 682147 RGDID:1586939 Length:510 Species:Rattus norvegicus


Alignment Length:372 Identity:82/372 - (22%)
Similarity:154/372 - (41%) Gaps:84/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ERVQARMYKTATAIREICKIVQDILKEVELQEPRF--ISSLVECNGRFEGVEVISPNEFEIVLYL 86
            ::::.:..:.:.|...:.|:|..:|:.::.:|..|  :..| .....:|.|::.:||||:::..|
  Rat   158 DKLRLKRKEISAAAETVNKVVDQLLRRMQRRESEFKGVEQL-NTGSYYEHVKISAPNEFDVMFKL 221

  Fly    87 N----------QMGVFNFVDDGTLPGCAVLKLSDGRKRSMSLWVEFITASGYLSSRKIRARFQTL 141
            .          :.|.|..|....:|          |...:|.::|    ...||:.|:.::|:.|
  Rat   222 EVPRIELEEYYETGAFYRVKFKRIP----------RGNPLSHFLE----GEVLSATKVLSKFREL 272

  Fly   142 VAQACDKSVYRDMVKMVGDTS-----------EVKLRIR--ERFVVQITPAFKCSGIWPRSAAHW 193
            :         ::.||.:.||.           .|.|.||  |...|.|..|.:..|.||.| ...
  Rat   273 I---------KEEVKEIKDTDVTVEEEKPGSPAVTLLIRNPEEISVDIILALESKGSWPIS-TKG 327

  Fly   194 PVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAASMEGDAWVLSFFEAENRLLQGG---- 254
            .:|...|....:...::.|.|.|:.|.:     |:.|  ..:|:.|.|||...|..:|...    
  Rat   328 GLPIQDWLGTKVRTNLRREPFYLVPKNA-----KDGN--RFQGETWRLSFSHTEKYILNNHGIGK 385

  Fly   255 ----------CRRRCLSMLKTLRD------RHLDLPGNPISAYHLKNLLLYECEKHPRDFEWDEG 303
                      ||:.||.::|.|.:      :.||    ...:||:|..:.:...|.|:|.:||..
  Rat   386 TCCESSGAKCCRKECLKLMKYLLEQLKREFQELD----AFCSYHVKTAIFHMWTKDPQDSQWDPR 446

  Fly   304 CIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSALEQAAKQ 350
            .::...:......:.||:..:..|||:|..::|   |...:::.:|:
  Rat   447 NLSTCFDKFLTFFLECLRTEKLDHYFIPKFNLF---SQELIDKKSKE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 75/326 (23%)
CgasXP_038938458.1 PHA03247 <2..143 CDD:223021
Mab-21 203..498 CDD:397398 75/326 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.