DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and mab21l3

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001103495.1 Gene:mab21l3 / 558164 ZFINID:ZDB-GENE-070912-242 Length:387 Species:Danio rerio


Alignment Length:400 Identity:92/400 - (23%)
Similarity:170/400 - (42%) Gaps:99/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MNRFCTERVQARMYKTATAIREICKIVQDILKEVELQEPRFIS---------SLVE--------- 64
            ::.:...:|..|..:.:..:.::.||::|:..||..::.||.|         ||.:         
Zfish     9 LDNYLLNQVDLRHRQVSKCVEDVQKIIKDLTTEVSSKDARFQSIANAGVHNASLKDQPALMSKWS 73

  Fly    65 --CNGRF---EGVEVISPNEFEIVLYLNQMGVFNFVDDG-------TLPGCAVLKLSDGRK-RSM 116
              ..||.   ..::|:||..:.|.:.|  .|:..:.:..       ||.|..:  ||..|: ..:
Zfish    74 ALLRGRCAYNPAIQVLSPTLYLISVPL--QGLMGYKERRTRQWRYYTLTGSRL--LSPVREPEKL 134

  Fly   117 SLWVEF--------------ITASGYLSSRKIRARFQTLVAQACDK-------SVYRDM---VKM 157
            ..|:|.              :|..|.:...|:...|:.|:..:...       ||...:   |::
Zfish   135 HQWLELESFVNPSQEWHDARMTIEGDIVPAKVVNVFKDLLETSIKTRGLTNKVSVLESVGTAVRV 199

  Fly   158 VGDTSEVKLRIRERFVVQITPAFKCSGIWPRSAAHWPVPHLPWPHPNIVAEVKTEGFDLLSKESV 222
            ..:|||.::.      |::.|..:....||: .|.||.....||.......:|:.||:|::..:.
Zfish   200 AVETSEAQIE------VKLVPTVELMNYWPK-RARWPRLFRRWPSTERARCIKSFGFNLMASSNY 257

  Fly   223 IMQNKNNNAASMEGDAWVLSFFEAENRLL-----QGGCRRRCLSMLKTLRDRHLD--LPGNP--I 278
                           .|:|||..||..||     .|||||:|..:::.|::   |  .||:.  |
Zfish   258 ---------------HWLLSFSRAEQVLLSNIDEDGGCRRKCYRVVRQLKE---DGWCPGSKPVI 304

  Fly   279 SAYHLKNLLLYECEKHPRDFEWDE--GCIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSP 341
            :|:||:.||.:.|||:|...:|.:  ||:...:.    :|..|:......|||:.:.::.|..:.
Zfish   305 TAFHLQTLLFWTCEKYPCTRDWKDFRGCVLRLVQ----KLHKCVSQHYLRHYFIRSHNLLKYSNT 365

  Fly   342 SALEQAAKQV 351
            :.|::.||::
Zfish   366 NELDEVAKKI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 79/329 (24%)
mab21l3NP_001103495.1 Mab-21 82..377 CDD:281298 78/326 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.