DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and Mb21d2

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001102526.2 Gene:Mb21d2 / 498100 RGDID:1559643 Length:491 Species:Rattus norvegicus


Alignment Length:401 Identity:86/401 - (21%)
Similarity:156/401 - (38%) Gaps:107/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YKTATAIREICKIVQDILK--EVELQEPR---------FISSLVECNGRFEGVEVISP--NEFEI 82
            :::...:.|:.|::|:..:  :.|..:.|         ||.|::   |..:.::...|  ||:.:
  Rat    27 FRSGARVEELNKLIQEFTRHDQREYDDQRALEIHTAKDFIFSML---GMVQKLDQKLPVANEYLL 88

  Fly    83 V----------LYLNQMGVF----NFVDDGTL--PGCAVLKLSDGR------------------- 112
            :          |.|:::.|:    ::..|.||  |   .|||.|..                   
  Rat    89 LSGGVREGVVDLDLDELNVYARGTDYDMDFTLLVP---ALKLHDRNQPVTLDMRHSALCHSWLSL 150

  Fly   113 ----KRSMSLWVEFITASGYL--------SSRKIRARFQ---TLVAQACDKSVYRDMVKMV---- 158
                :.::|.|.:..|.:.::        |..|:...|.   ::|.....|...|.|.|:.    
  Rat   151 RLFDEGTISKWKDCCTIADHINGATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEK 215

  Fly   159 -GDTSEVKLRI-RERFVVQITPAFKCSGIWPRSAAHWPVPHLPWPHPNIVAEVKTEGFDLLSKES 221
             |....:.|.: ..|.:..|.|.....| ||..|..|.:.:..| ...|..|....||.|:.   
  Rat   216 NGTIISIILGVGSSRMLYDIVPVVSFKG-WPAVAQSWLMENHFW-DGKITEEEVISGFYLVP--- 275

  Fly   222 VIMQNKNNNAASMEG---DAWVLSFFEAENRLLQGGCRRRCLS--------MLKTLRDRHLDLPG 275
                     |.|.:|   :.|.|||..:|.:|      ::|:|        ..|.:..:.|..| 
  Rat   276 ---------ACSYKGKKDNEWRLSFARSEVQL------KKCISGSLMQAYQACKAIIIKLLSRP- 324

  Fly   276 NPISAYHLKNLLLYECEKHPRDFEWDEGCIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKS 340
            ..||.|||::::|:.|::.|..:...|...|..:.|:...|..||..:.||:||:|..:|.:..|
  Rat   325 KAISPYHLRSMMLWACDRLPVSYLAQEDYAAHFLLGLIDDLQHCLVNKMCPNYFIPQCNMLEHLS 389

  Fly   341 PSALEQAAKQV 351
            ...:...|:::
  Rat   390 EETVMLHARKL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 77/353 (22%)
Mb21d2NP_001102526.2 Mab-21 161..401 CDD:281298 62/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.