DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and Tmem102

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001028605.2 Gene:Tmem102 / 380705 MGIID:1921591 Length:509 Species:Mus musculus


Alignment Length:218 Identity:52/218 - (23%)
Similarity:77/218 - (35%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RERFVVQITPAFKCSGIWPRSA-AHWPVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAA 232
            |...:..:.|....:| ||.:| :|      .|..| :|:|         |....::........
Mouse   312 RHLLLFDLIPVVTVTG-WPDTARSH------SWAGP-LVSE---------SASFYLVPGSLPEQP 359

  Fly   233 SMEGDAWVLSFFEAE--------NRLLQGGCRRRCLSMLKTLRDRHLDLPGNPISA-YHLKNLLL 288
            |..|  |.|.|...|        ..|||.....:.|  |:.|      :.|...:| |.|:.||.
Mouse   360 STSG--WQLCFARQELALKERIPTPLLQAHAAAQAL--LRPL------VAGTRAAAPYLLRTLLY 414

  Fly   289 YECEKHP-----RDFEWDEGCIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSALEQAA 348
            :.||:.|     |.......|:     |:..:|...|:....|||||....:..|...:||..|.
Mouse   415 WACERLPALYLARPENAGACCL-----GLLDELSRVLEAGALPHYFLSGRKLRVGDGSAALRGAL 474

  Fly   349 KQV----WRLTRELLTNANAFEK 367
            .|:    .:..||.:..|....|
Mouse   475 AQLRGDPAQALREAVEEAKVARK 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 48/202 (24%)
Tmem102NP_001028605.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..236
Mab-21 <318..456 CDD:281298 40/169 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.