DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and CG15865

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_573143.1 Gene:CG15865 / 32641 FlyBaseID:FBgn0015336 Length:1084 Species:Drosophila melanogaster


Alignment Length:255 Identity:52/255 - (20%)
Similarity:88/255 - (34%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YLSSRKIRARF----------QTLVAQ----ACDK---SVYRDMVKMVGDTSEVKLRIRERFVVQ 175
            ||||::....|          |..::|    ||..   |||               ..||    :
  Fly   427 YLSSQQFMLYFGEVLRHHLANQLGISQSQLAACSYRGCSVY---------------TARE----E 472

  Fly   176 ITPAFKCSGIWPRSAAHWPVPHLP------------WPHPNIVAEVKTEGFDLLSKESVIMQNKN 228
            :.||......||..|..:.:...|            ||...:...:::.||.:: ......:...
  Fly   473 LVPAIHVPNSWPDCAFEFWLRARPRLTNLHTAEQFQWPTEQMKKRIRSMGFHVV-PVGYAPKRSR 536

  Fly   229 NNAASMEGDAWVLSFFEAENRLLQGGCRRRCLS------------MLKTLRDRHL----DLPGNP 277
            |....:|   |.:.|.:||..|     .|.||:            ::||..|...    ..||..
  Fly   537 NPFRELE---WRIVFPQAEQFL-----ERHCLTPMQLKVFQLMKLLVKTFVDESTTSCDQSPGAL 593

  Fly   278 ISAYHLKNLLLYECEKHPRDFEWDEGCIADRINGIFLQLISCLQYRRCPHYFLPALDMFK 337
            :.  .|:..:.::||:|..|  |.|..:.:|:........:||..:....||:...::|:
  Fly   594 LE--QLRAHMFWQCEQHSND--WPEEFLGERLVRFIRSFDACLAKKHLSDYFIERRNLFE 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 52/255 (20%)
CG15865NP_573143.1 Mab-21 <472..656 CDD:281298 38/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.