DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and Mab21l3

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001099926.1 Gene:Mab21l3 / 295326 RGDID:1308694 Length:429 Species:Rattus norvegicus


Alignment Length:373 Identity:90/373 - (24%)
Similarity:159/373 - (42%) Gaps:84/373 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RVQARMYKTATAIREICKIVQDILKEVELQEPRFISSLVECNGRF-EGVEVISPNEFEIVLYLNQ 88
            ::..|..:.:..:.|:.|||..:..|:...:.||  ..|..:..: :.::|::|:.|.:.:.|..
  Rat    83 KMDLRQQQISQTVEEVQKIVHLLTTEISHHDSRF--EAVPASDTYNDSIKVLAPSLFHVTVPLRG 145

  Fly    89 MGVFNFVD---------DGTLPGCAVLKLSDGRKRSMSLWVEF--------------ITASGYLS 130
            :..:..|.         .||...|. |:..:|    :..|:|.              :...|.:.
  Rat   146 LAGYKGVRTPRWRYYSLQGTKLSCP-LRDPEG----LQQWLETETFMKTLWQWHKVDVNIEGDIV 205

  Fly   131 SRKIRARFQTLVAQA---CDKS------VYRDMVKMVGDTSEVKLRIRERFVVQITPAFKCSGIW 186
            ..|:...||.||..|   |..|      ..|..|.:..:||..::.:      ::.|..:....|
  Rat   206 PAKVLQIFQMLVENAVRTCHLSGKVTVLEKRTTVWVAVETSTGQVEL------ELAPTVEIPTTW 264

  Fly   187 PRSAAHWPVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAASMEGDAWVLSFFEAENRLL 251
            |.. |.||.....||.|..|..:|:.||:|:::.:.               .|.|||.:||..|.
  Rat   265 PEK-AQWPRCLKRWPSPERVECIKSFGFNLVAQSTY---------------HWQLSFSQAERVLC 313

  Fly   252 Q-----GGCRRRCLSMLKTLRDRHLDL--PGN--PISAYHLKNLLLYECEKHPRDFEWDEGCIAD 307
            :     |||||||..:|:.|::   |:  ||.  .|:.:||:.:|.:.|||:|...:|..     
  Rat   314 EQLDEDGGCRRRCFQVLRQLKE---DVWCPGRRPVITTHHLQTVLFWTCEKYPHLKDWQV----- 370

  Fly   308 RINGIFLQLI----SCLQYRRCPHYFLPALDMFKGKSPSALEQAAKQV 351
             .:..||:|:    .|:......|||:|..::|:..:||.|:..|::|
  Rat   371 -FHQAFLRLVRKLHRCVSQHFLKHYFVPKSNLFQSANPSELDAVAQKV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 81/330 (25%)
Mab21l3NP_001099926.1 Mab-21 125..418 CDD:281298 81/329 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.