DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and TMEM102

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001307373.1 Gene:TMEM102 / 284114 HGNCID:26722 Length:508 Species:Homo sapiens


Alignment Length:191 Identity:44/191 - (23%)
Similarity:63/191 - (32%) Gaps:47/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RERFVVQITPAFKCSGIWPRSA-AHWPVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAA 232
            |...:..:.|....:| ||..| :|      .|..|            |.|:.:...........
Human   311 RRLLLFDLIPVVSVAG-WPEGARSH------SWAGP------------LASESASFYLVPGGGTE 356

  Fly   233 SMEGDAWVLSFFEAE--------NRLLQGGCRRRCLSMLKTLRDRHLDLPGNPISA-YHLKNLLL 288
            .....||.|.|...|        ..|||.....:.|  |:.|      :.|...:| |.|:.||.
Human   357 RPCASAWQLCFARQELALKARIPAPLLQAHAAAQAL--LRPL------VAGTRAAAPYLLRTLLY 413

  Fly   289 YECEKHP-----RDFEWDEGCIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSAL 344
            :.||:.|     |.......|:     |:..:|...|:....|||||....:..|...:||
Human   414 WACERLPALYLARPENAGACCL-----GLLDELGRVLEAGTLPHYFLNGRQLRTGDDSAAL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 44/191 (23%)
TMEM102NP_001307373.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..231
Mab-21 <317..455 CDD:308741 38/169 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.