DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and CG30424

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster


Alignment Length:345 Identity:74/345 - (21%)
Similarity:129/345 - (37%) Gaps:110/345 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VEVISPNEFEIVL-----YLNQMGVFNFVDDGTLPGCAVLKLS------------DGRKRSMSLW 119
            :::..||||::|.     |...:.|   ..|..:||..:|.::            |.::....:.
  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAV---TRDPKIPGNVLLDMTRVLELLKDDPREDFQRIRELIQ 63

  Fly   120 VEFITASGYLSSRKIRARFQTLVAQACDKSVYRDMVKMV-GDTSEVKLRI-----------RERF 172
            ...:.|..:....::|:..|:|.:||.::..||  |::| |..|.:|.|.           ...:
  Fly    64 GRLVDAQNFFVVDRLRSWLQSLFSQALNRISYR--VELVAGVVSHLKYRTCGPAHTIYVYGDYEY 126

  Fly   173 VVQITPAFKC----SGIWP---------RSAAHW---PVPHLPWPHPNIVAEVKTEGFDLLSKES 221
            .|...||. |    ..:.|         .:.::|   |.|..|                 |::.|
  Fly   127 SVDYVPAI-CLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKP-----------------LTETS 173

  Fly   222 VIMQNKNNNAASMEGDAWVLSFFEAENRLLQG---GCRRRCLSMLKTLRDRHLDLPGNPISAYHL 283
            :|              ::..||:..|..|||.   .| |..:..:|..||...:| || ..:|::
  Fly   174 MI--------------SFRSSFYAVEKILLQDVHENC-RNAIRFMKKFRDVKTNL-GN-CKSYYI 221

  Fly   284 KNLLLYECEKHPRDFEWDEG---CIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSALE 345
            |.|.|::..:.|..: |...   .:||    :|..|...|:......::.|.|:|.     .||.
  Fly   222 KTLFLWKIIQEPESY-WLNPLSFILAD----MFDDLAENLRRGVITFFWDPELNMI-----DALT 276

  Fly   346 QAAKQVW-------RLTREL 358
            :  .|||       |:.|:|
  Fly   277 R--DQVWEMYLCVQRIPRDL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 71/338 (21%)
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 71/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.