DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and Mab21l3

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_758499.3 Gene:Mab21l3 / 242125 MGIID:2446273 Length:429 Species:Mus musculus


Alignment Length:381 Identity:90/381 - (23%)
Similarity:157/381 - (41%) Gaps:100/381 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RVQARMYKTATAIREICKIVQDILKEVELQEPRFISSLVECNGRFEGVEVISPNEFEIVLYLNQM 89
            :|..|..:.:..:.|:.||:..:..|:..|:.|| .::...:...|.::|::|:.|.:.:.|..:
Mouse    83 KVDLRRQQISQTMEEVQKIIHLLTTEISRQDSRF-EAVPVSDTHNESIKVLAPSLFHVTVPLKGL 146

  Fly    90 GVFNFVD---------DGTLPGCAVLKLSDGRKRSMSLWVEF--------------ITASGYLSS 131
            ..:..|.         .|....|. |:..:|    :..|:|.              :...|.:..
Mouse   147 AGYKGVQRQRWRYYNVQGAKLTCP-LRDPEG----LQQWLETEMFMKTLWQWHKADVNIEGDIVP 206

  Fly   132 RKIRARFQTLVAQA---CDKS-----------VYRDMVKMVGDTSEVKLRIRERFVVQITPAFKC 182
            .|:...|:|||..|   |..|           |:   |.|...|.:|:|        ::.|..:.
Mouse   207 AKVLQVFRTLVENAVRTCHLSGKVTVLEKRTTVW---VAMETSTGQVEL--------ELAPTVEI 260

  Fly   183 SGIWPRSAAHWPVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAASMEGDAWVLSFFEAE 247
            ...||.. |.||.....||.|..|..:|:.||:|:::.:.               .|.|||.:||
Mouse   261 PTTWPEK-AQWPRCLKRWPSPERVECIKSFGFNLVAQSAY---------------HWQLSFSQAE 309

  Fly   248 NRLLQ-----GGCRRRCLSMLKTLRDRHLDL--PGN--PISAYHLKNLLLYECEKHPRDFEWDEG 303
            ..|.:     |||||:|..:|:.|::   |:  ||.  .|:.:||:.:|.:.|||:|...:|.  
Mouse   310 QVLFEQLDEDGGCRRQCFQVLRQLKE---DVWCPGRRPVITTHHLQTVLFWTCEKYPHLKDWQ-- 369

  Fly   304 CIADRINGIFLQ--------LISCLQYRRCPHYFLPALDMFKGKSPSALEQAAKQV 351
                    :|.|        |..|:......|||:|..::.:..:||.|:..|::|
Mouse   370 --------VFHQALLRLVRKLHRCVSQHFLKHYFVPKSNLLQSANPSELDAVAQKV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 81/338 (24%)
Mab21l3NP_758499.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Mab-21 125..418 CDD:367433 81/338 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.