DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and MAB21L3

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_689580.2 Gene:MAB21L3 / 126868 HGNCID:26787 Length:362 Species:Homo sapiens


Alignment Length:363 Identity:85/363 - (23%)
Similarity:163/363 - (44%) Gaps:64/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RVQARMYKTATAIREICKIVQDILKEVELQEPRFISSLVECNGRF-EGVEVISPNEFEIVLYLNQ 88
            :|..|..:.:.|:.|:.|:|..:...:..|:.||  ..|..:..: |.::|::|::|.:.:.:..
Human    16 KVDLRRQQISQAVEEVQKVVHHLTTNISNQDIRF--QAVPYSDTYNENIKVLAPSQFLVTVPIKG 78

  Fly    89 MGVFN---------FVDDGTLPGCAVLKLSDGRK---------RSMSLWVEF-ITASGYLSSRKI 134
            :..:.         :...||...|. |:..:|.:         :|:..|.|. :...|.:...|:
Human    79 LAGYREAREQHWRYYTLQGTRLPCP-LRDPEGLQQWLEVEQFMKSLWQWHETDVNIDGDIVPAKV 142

  Fly   135 RARFQTLVAQACDKSVYRDMVKMVGDTSEVKLRIRE---RFVVQITPAFKCSGIWPRSAAHWPVP 196
            ...|:.||..|.........|.::|:.|.|.:.:..   :..:::.||.:....|.:. |.||..
Human   143 LLVFRKLVENAVRTCHLSGKVSLLGNRSAVWVAVETSAYQVELELVPAVEIPTTWSKK-ARWPRC 206

  Fly   197 HLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAASMEGDAWVLSFFEAENRLLQ-----GGCR 256
            ...||....|..:|:.||:||:..:.               .|.|||..||..||:     ||||
Human   207 LQRWPSQERVECIKSFGFNLLACSNY---------------HWQLSFLRAEQVLLEQLDEDGGCR 256

  Fly   257 RRCLSMLKTLRDRHLDL--PGN--PISAYHLKNLLLYECEKHPRDFEWDEGCIADRINGIFLQLI 317
            |:|..:::.|::   |:  |||  .|:::||:.:|.:.|||:|...:|..      .:..||:|:
Human   257 RKCFQVMRHLKE---DIWCPGNRPVITSHHLQTVLFWTCEKYPHFKDWQV------FSKAFLRLV 312

  Fly   318 ----SCLQYRRCPHYFLPALDMFKGKSPSALEQAAKQV 351
                .|:......|||:...::|:..:|:.|:..|:::
Human   313 RKLHKCVSQHFLKHYFVRNSNLFQCTNPTELDTVAQKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 75/320 (23%)
MAB21L3NP_689580.2 Mab-21 58..351 CDD:308741 75/319 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.