DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4766 and tmem102

DIOPT Version :9

Sequence 1:NP_572287.1 Gene:CG4766 / 31533 FlyBaseID:FBgn0027546 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001314791.1 Gene:tmem102 / 100536810 ZFINID:ZDB-GENE-160728-39 Length:522 Species:Danio rerio


Alignment Length:195 Identity:50/195 - (25%)
Similarity:81/195 - (41%) Gaps:25/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RFVVQITPAFKCSGIWPRSAAHWPVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAASME 235
            |.:..:.|.....| ||..|..|...:..| ...|..|....||.||...|..:      ::|:.
Zfish   253 RILYDLLPVVSFRG-WPAVAQGWLTTNHFW-DGKITEEEAISGFYLLPCCSPAV------SSSIR 309

  Fly   236 GD-AWVLSFFEAENRLLQGGCRRRCL--------SMLKTLRDRHLDLPGNPISAYHLKNLLLYEC 291
            .| .|.|::..:|.:|      ::|:        ...|.:..|.|..|...:|.|||:.|:.:.|
Zfish   310 PDREWRLAYSRSEVQL------KKCVPYPMAQAFQAAKAVLSRLLARPRTGLSLYHLRTLMFWAC 368

  Fly   292 EKHPRDFEW--DEGCIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSALEQAAKQVWRL 354
            ::.|..:..  |....|....|:...|..|:..:.||:||||..:|.:..|.||....|:::..|
Zfish   369 DRLPSTYLSCPDHETPARLFLGLLDDLAHCILGKNCPNYFLPQCNMLEHLSDSAALLVARKLAHL 433

  Fly   355  354
            Zfish   434  433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4766NP_572287.1 Mab-21 68..353 CDD:281298 49/192 (26%)
tmem102NP_001314791.1 Mab-21 <201..432 CDD:281298 49/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3963
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.