DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG17191

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:304 Identity:79/304 - (25%)
Similarity:134/304 - (44%) Gaps:53/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DPESVQGMGMNPKGKIFLLVHG----YLESGEIPWMWDMAKALLAHEPEGRASVVLIDWGGGASP 158
            |..|::....:.......::||    |.:...:    .:.:|.|:   :|..:|::::|....|.
  Fly    82 DASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNV----KITRAWLS---KGDYNVIVVNWDRAQSV 139

  Fly   159 PYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPARI 223
            .|:.:|..:...||....::..|:|...| :::::.:||||||||::||||..:.   |.:...|
  Fly   140 DYISSVRAVPGAGAKVGEMIEYLHEHHHL-SMESLEVIGHSLGAHVAGYAGKQVG---GKRVHTI 200

  Fly   224 TGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCN 288
            .|||||.|||....|..||...||.:|:.:.|:.     |..|....:|...|:||||.:.|||.
  Fly   201 VGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNG-----GEKGFLKPIGKGTFYPNGGRNQPGCG 260

  Fly   289 KKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLGITCDSFESFKDTKCTSCEEPGH 353
            ......               |.|.||..|:.|:: ::..|..|.|..:::....:|.|.    :
  Fly   261 SDIGGT---------------CAHGRSVTYYVEAV-TEDNFGTIKCHDYQAALANECGST----Y 305

  Fly   354 TCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPFCRL 397
            :.:|||         .|....:..||    ||:......||.::
  Fly   306 SGVRMG---------AVTNAYMVDGD----FYVPVNGQAPFGKI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 77/299 (26%)
Pancreat_lipase_like 76..390 CDD:238363 77/295 (26%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 77/294 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.