DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG4582

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:411 Identity:104/411 - (25%)
Similarity:164/411 - (39%) Gaps:101/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MLYLANHTSRAAVNTLVDLPPAPKSDINEVKCFGVYGCFPINGP-----------------WNTV 62
            :||.|.|.:...::|||     |:.:.|..           .||                 .||:
  Fly    73 LLYSAEHHTYFHLHTLV-----PQDNANRQ-----------TGPLKSEKESPHRRLFQQVVGNTL 121

  Fly    63 TRS--INVHPQKPSEIEPHFTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGE 125
            |.:  :||..:...|....||       .:|  ::|.|..|::....:|.....:|:||:|.:..
  Fly   122 TAAFGLNVMNKGDQEQNQQFT-------SEP--VNLYDAASLRRSRFSPFNPTRILIHGWLGNEN 177

  Fly   126 -------IPWMWDMAKALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYE 183
                   :|..:|:.        .|..::..:|||.||...|:.|...::.||.:.|..|..|::
  Fly   178 ANMYNELLPAYFDLR--------NGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQ 234

  Fly   184 ELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAH 248
            |..: ..:::.::|.|:|||::|.||.|||..   :...|..||||.|.|....|..||...||.
  Fly   235 EAGM-RFEDLQLVGFSMGAHVAGLAGKHLQTG---RLRMIRALDPALPFFRYAKPKERLTAEDAD 295

  Fly   249 FVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHI 313
            :|:::||..     |..|.:..:|||||:.|.|...|||                  .:..|:|.
  Fly   296 YVEVLHTSV-----GSYGFDRPVGHVDFYANWGSQQPGC------------------FWHECSHW 337

  Fly   314 RSQQYFTESIG--SQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQ 376
            |:...|.||:.  ....||...|.:.|..:.|:...|.:.......||          .||..:.
  Fly   338 RAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMG----------GDLANVS 392

  Fly   377 Q---GDSPGVFYLWTGDSKPF 394
            .   ....||:|..|.|..|:
  Fly   393 AEFLAQRQGVYYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 94/378 (25%)
Pancreat_lipase_like 76..390 CDD:238363 85/325 (26%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 85/324 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.