DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG10116

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:350 Identity:93/350 - (26%)
Similarity:142/350 - (40%) Gaps:107/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EPHFTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEP 141
            |..|.|:|||               ||......:.::..||.               .:..|.:|
  Fly    21 ETGFFLNTRR---------------VQENAQPIEAEVEALVR---------------SSFYAADP 55

  Fly   142 EGRASVVLID-WGGGASPPYVQAVANIRL---------------------VGAITAHVVHMLYEE 184
                :||.|. |.|..|.|.:.||.:.||                     :.:: |.:|.:|:.:
  Fly    56 ----TVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVDLSEANDETEIIDSV-ASLVIVLHNQ 115

  Fly   185 LRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHF 249
            ..:| ||.:.::|.:.||||:|.....:|.|.|.:.::||.|||::....|.    :|.:.||.|
  Fly   116 FDMP-LDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPSSGAELDH----KLSQADAEF 175

  Fly   250 VDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIR 314
            |::|||:|     ||.|...||||||::||||...|||...                  .|:|.|
  Fly   176 VEVVHTNA-----GGEGTWERLGHVDYYPNGGQTQPGCTTD------------------SCSHER 217

  Fly   315 SQQYFTESIGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGD 379
            :.:...|....:..|:...|.|.|:...:.|           |...|.         :||.|:.:
  Fly   218 AFELLAEMWSPENDFVSARCGSVETLSASSC-----------RWSTHK---------MGQKQEEE 262

  Fly   380 SP--GVFYLWTGDSKPFCRLHYRIT 402
            .|  |:::|.|..|.||.|..|.|:
  Fly   263 QPASGIYFLETRQSSPFSRGAYFIS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 88/340 (26%)
Pancreat_lipase_like 76..390 CDD:238363 87/336 (26%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 85/332 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.