DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG10357

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:305 Identity:98/305 - (32%)
Similarity:144/305 - (47%) Gaps:46/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LNDPESVQGMGMNPKGKIFLLVHGYLES---GEIPWMWDMAKALLAHEPEGRASVVLIDWGGGAS 157
            |:..|||:           |:|||||.|   |.|..:.:      |:..:|..:|::.|||..|:
  Fly    49 LSSVESVK-----------LIVHGYLGSCTHGSIMPLRN------AYTAQGYENVLVADWGPVAN 96

  Fly   158 PPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPAR 222
            ..|..:...::.|..|.|.::....:...: :|:.||:||||||||::|..|.:.....|    |
  Fly    97 LDYPSSRLAVKNVAQILAKLLEEFLQRHGI-SLEGVHVIGHSLGAHIAGRIGRYFNGSLG----R 156

  Fly   223 ITGLDPAAPLFTD-TDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGF-DNP 285
            :||||||.|||:. :|.  .|....|.|||::||| .||    .|.....|.|||:||.|. ..|
  Fly   157 VTGLDPALPLFSSRSDD--SLHSNAAQFVDVIHTD-YPL----FGDIRPRGTVDFYPNFGLAPQP 214

  Fly   286 GCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLGITCDSFESFKDTKCTSC-E 349
            ||..  .|||....|   :.|...|:|.|:..::.||||....|..::| |..:.|..:...| .
  Fly   215 GCEN--VDVVAASKL---LHEAYSCSHNRAVMFYAESIGMPENFPAVSC-SLTAIKSRRVEDCLR 273

  Fly   350 EPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPF 394
            |...|    ...:..||| .|.:|:.....:...:||.|..:.|:
  Fly   274 EKSKT----NTENANDYQ-TVFMGEHVNRSATLYYYLETNGAPPY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 97/303 (32%)
Pancreat_lipase_like 76..390 CDD:238363 97/299 (32%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 96/298 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.