DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG6431

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:120/310 - (38%) Gaps:75/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DINEVKC-----------FGVYGCFPINGPWNTVTRSINVHPQKPSEIEPHFTLHTRRALDQPKY 93
            |:|.:.|           |..|..|..|||                          ||...    
  Fly    42 DLNPLNCHILLWETCPKRFIDYQLFTSNGP--------------------------RRGTP---- 76

  Fly    94 LDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEPEGRASVVLIDWGG-GAS 157
            |::.:|.::...|.:...:...::||:..:.....:..:..|.|:.:    .:|:.:||.. ...
  Fly    77 LNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSRD----FNVITVDWRPLTRY 137

  Fly   158 PPYVQAVANIRLVGAITAHVVHML--YEELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKP 220
            |.|:.::.|.||....||.:...|  |..:|    :.:..:|||||||:.|....||..    |.
  Fly   138 PCYLHSLINTRLTAQCTAQIYAFLTHYGAVR----ERITCVGHSLGAHICGMISNHLTR----KQ 194

  Fly   221 ARITGLDPAAPLFTD-TDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDN 284
            .||.|||||.||... .....||...||:.:.::||:|     |.||.....||:::..|||...
  Fly   195 YRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNA-----GFLGQEDNSGHLNYCVNGGRIQ 254

  Fly   285 PGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLGITC 334
            |.|  |...:.|.:           |:|..|..|...:......|:|:.|
  Fly   255 PFC--KGNPIRKSR-----------CSHFLSICYLATATFKHNKFMGVPC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 75/304 (25%)
Pancreat_lipase_like 76..390 CDD:238363 68/263 (26%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 73/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.