DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG14034

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:390 Identity:107/390 - (27%)
Similarity:165/390 - (42%) Gaps:84/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MLQTMLYLANHTSRAAVNTLVDLPPAPKSDINEVKCFGVYGCFPINGPWNTVTRSINVHPQKPSE 75
            |:..:|.|...:|...|..|.|:                 .||.:.   |.:..:.|:       
  Fly     1 MMNNILVLIGFSSVMLVAGLDDM-----------------NCFSLQ---NEICPNANI------- 38

  Fly    76 IEPHFTLHTRRALDQPK--YLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLA 138
               .|.|:|:...:..|  ..:||..|......:.      :|:||:....:......:....|.
  Fly    39 ---SFWLYTKENQEGTKLSVFELNRFEFYHHKPLK------VLIHGFNGHRDFSPNTQLRPLFLT 94

  Fly   139 HEPEGRASVVLIDWGGGA-SPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGA 202
            .:    .:::.:|:...| .|.|.:||.|.:.|...||.::.:|.|. .|..::::|:||..|||
  Fly    95 QD----YNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLES-GLVKIEDLHLIGLGLGA 154

  Fly   203 HLSGYAGYHL-QHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLG 266
            |::|:.|..| :|    |...||.||||.|.:...||.::||.|||.|||:||||...     ||
  Fly   155 HVAGFIGQFLPEH----KLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTM-----LG 210

  Fly   267 INMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLG 331
            :...:|||||:.|.|...|.|.    .:.|.:|.|        |.|.|:..|:.|||.|...|.|
  Fly   211 LLDAVGHVDFYLNMGVSQPNCG----PINKMETHF--------CYHNRAADYYAESISSPSGFYG 263

  Fly   332 ITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPFCR 396
            ..|.:|:||....|.    |......||:|        ||      ..:.|.::|.|.:..|:.:
  Fly   264 FYCPNFKSFAKGICI----PDKNIELMGFH--------VD------PKARGRYFLDTNNGPPYAK 310

  Fly   397  396
              Fly   311  310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 99/351 (28%)
Pancreat_lipase_like 76..390 CDD:238363 95/317 (30%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 95/325 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.