DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG18641

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:331 Identity:97/331 - (29%)
Similarity:153/331 - (46%) Gaps:43/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QKPSEIEPH----FTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWD 131
            |||... ||    |.|:|||..:||:::|:.||.::.....||:....:::||:.....:....|
  Fly    60 QKPYRC-PHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPD 123

  Fly   132 MAKALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAI-TAHVVHMLYEELRLPNLDNVHI 195
            :.:|..:   .|..:::::|:......|.:..:......|:: .:.:|..|....|....|::|.
  Fly   124 LREAYFS---VGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHF 185

  Fly   196 IGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPL 260
            ||:|:|||::|....:|:.:.| |..|||.|||....:...:....||.|||||||::||.|   
  Fly   186 IGYSVGAHIAGLVANYLKPEEG-KLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGA--- 246

  Fly   261 MKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGS 325
              |.||.....||.||:.|||...|.|       |...|||.|    |.|:|.:...||.|||.:
  Fly   247 --GILGQWHSSGHADFYVNGGTRQPAC-------VGSATLFQT----LACDHTKVTPYFIESITT 298

  Fly   326 QCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGD 390
            ...|....|.:..|:                .:|:...:| .|.|.:|:.....:.|.:|:.|..
  Fly   299 TRGFYAGPCPNLFSY----------------LIGWCEPKD-SEYVLMGEHCSHKARGNYYVTTNA 346

  Fly   391 SKPFCR 396
            ..||.|
  Fly   347 KAPFAR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 94/327 (29%)
Pancreat_lipase_like 76..390 CDD:238363 91/318 (29%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 89/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.