DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and Yp2

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:348 Identity:85/348 - (24%)
Similarity:138/348 - (39%) Gaps:59/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VNTLVD-LPPAPKSDINEVKCFGVYGCFPINGPWNTVTRSINVHPQKPSEIEPHFTLHTRRALDQ 90
            :||||: :....|...:||..| :.|....|......||.:....|:...::|:.|  |..:.::
  Fly   115 LNTLVEKVKRQQKFGDDEVTIF-IQGLPETNTQVQKATRKLVQAYQQRYNLQPYET--TDYSNEE 176

  Fly    91 PKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEPEGRASVVLIDWGGG 155
            ......::.:..|....|               ||             .:......:::|..|..
  Fly   177 QSQRSSSEEQQTQRRKQN---------------GE-------------QDDTKTGDLIVIQLGNA 213

  Fly   156 ASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKP 220
            .......|..||..:|.|..:.:..|...:.:|. :.:|:||....||::|.||.......|.|.
  Fly   214 IEDFEQYATLNIERLGEIIGNRLVELTNTVNVPQ-EIIHLIGSGPAAHVAGVAGRQFTRQTGHKL 277

  Fly   221 ARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNP 285
            .|||.|||........:.:..|.:.||.|||.:||.|.     |:|.:.||.:|||||||    |
  Fly   278 RRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAY-----GMGTSQRLANVDFFPNG----P 333

  Fly   286 GCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESI--GSQCPFLGITCDSFESFKDTKCTSC 348
            .......|.|.:.|:             |:.:||.||:  |::..|..:...|::.:|..|  ..
  Fly   334 STGVPGADNVVEATM-------------RATRYFAESVRPGNERNFPSVAASSYQEYKQNK--GY 383

  Fly   349 EEPGHTCLRMGYHSQEDYQEQVD 371
            .:.|:..:...:..|.||..||:
  Fly   384 GKRGYMGIATDFDLQGDYILQVN 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 78/328 (24%)
Pancreat_lipase_like 76..390 CDD:238363 72/298 (24%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 85/348 (24%)
Abhydrolase <221..407 CDD:304388 63/211 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.