DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and CG1986

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:336 Identity:102/336 - (30%)
Similarity:150/336 - (44%) Gaps:81/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EPHFTLHTRRALDQPKYLDLNDPESVQGM-GMNPKGKIFLLVHGYLESGEIPWM------WDMAK 134
            |.||.            |.|.|   ::|. .::|..|:.|.:||:.:.|...|:      |.:. 
  Fly    73 EVHFN------------LQLGD---LRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLF- 121

  Fly   135 ALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPN---LDNVHII 196
                   :...:|.::|||..:...|..|..:|..||...|.:: |..|||| ||   ..||.:.
  Fly   122 -------DSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGII-MALEELR-PNHFHRSNVTLA 177

  Fly   197 GHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFT---DTDPIVRLDKTDAHFVDIVHTDAN 258
            |:|||||.:||||..|:.    :..:|.|||||.|||:   :..|..|||..||.||.::||.. 
  Fly   178 GYSLGAHAAGYAGAVLEG----QVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSG- 237

  Fly   259 PLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEF-----LGCNHIRSQQY 318
                |.||.:::.||.||:|||| ..|..|.|         :|..:::.     :.|:|..:..:
  Fly   238 ----GSLGTSLKCGHADFYPNGG-RAPQTNCK---------MFANLRDMQNTNPVSCSHSAAAIF 288

  Fly   319 FTESIGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGV 383
            |.:|:..:.||:|..|.|:..|....|     .|:...|.|.|||...|              |.
  Fly   289 FRQSMDPEYPFVGYECGSYREFAAGYC-----DGNRKARFGIHSQRRAQ--------------GS 334

  Fly   384 FYLWTGDSKPF 394
            ||..|...:|:
  Fly   335 FYFRTAPQQPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 101/334 (30%)
Pancreat_lipase_like 76..390 CDD:238363 101/330 (31%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 101/330 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.