DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and lpl

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002934038.1 Gene:lpl / 100127862 XenbaseID:XB-GENE-951545 Length:483 Species:Xenopus tropicalis


Alignment Length:346 Identity:106/346 - (30%)
Similarity:161/346 - (46%) Gaps:49/346 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SEIEPHFTLHTRRALDQPK----YLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEI-PWMWDMA 133
            :.||..|:|   |.|::|.    ||......:|.....|...|.|:::||:..:|.. .|:..:.
 Frog    43 NSIESKFSL---RTLEEPDDDTCYLVPGQEHTVDQCNFNHTSKTFVVIHGWTVTGMFESWVPKLV 104

  Fly   134 KALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGH 198
            .||...||:  ::|:::||...|...|..:....:|||...|..:..:.:.::.| :||:||:|:
 Frog   105 DALYKREPD--SNVIVVDWLTRAQQHYPVSAEYTQLVGQDVASFIDWMDDTIQYP-IDNIHILGY 166

  Fly   199 SLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKG 263
            |||||.:|.||.....    |..||||||||.|.|...:..:.|...||.|||::||........
 Frog   167 SLGAHAAGVAGSLTNK----KVNRITGLDPAGPTFEYAENAIILSPDDAEFVDVLHTYTRGSPDR 227

  Fly   264 GLGINMRLGHVDFFPNGGFDNPGCN----------KKFQDVVKKKTLFLTMQEFLGCNHIRSQQY 318
            .:||...:||:|.:||||...||||          |.|.||          .:.:.|:|.||...
 Frog   228 SIGIQKPVGHIDIYPNGGSFQPGCNLGEALRLIAEKGFGDV----------DQLVKCSHERSIHL 282

  Fly   319 FTES-IGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPG 382
            |.:| :..:.|.:...|:|.|:|:...|.||.:  :.|..:||...:           .:|....
 Frog   283 FIDSLLYEEKPSMAYRCNSKEAFEKGLCLSCRK--NRCNTLGYKVNK-----------VRGKRST 334

  Fly   383 VFYLWTGDSKPFCRLHYRITV 403
            ..||.|....||...||::.|
 Frog   335 KMYLKTRAQMPFKVFHYQVKV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 101/335 (30%)
Pancreat_lipase_like 76..390 CDD:238363 101/329 (31%)
lplXP_002934038.1 lipo_lipase 41..476 CDD:132274 106/346 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D247005at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.