DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5966 and lipib

DIOPT Version :9

Sequence 1:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:429 Identity:130/429 - (30%)
Similarity:197/429 - (45%) Gaps:81/429 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LVHGYLESGEIP-WMWDMAKALLAHEPEGRASVVLIDWG-GGASPPYVQAVANIRLVGA-ITAHV 177
            ::|||..:|..| |:..:...|.|.:.   .:::::||. |.|:..|:.||||.|.... ||..:
Zfish    78 VIHGYRPTGAPPIWINHIVHLLAAQKD---MNILVVDWNRGAANLNYLTAVANTRGTALNITRFI 139

  Fly   178 VHMLYEELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRL 242
            ..|   |....:||::|:||.|||||::|:.|..|    |.:..||||||||.|:|....|..||
Zfish   140 ESM---EKEGASLDSIHLIGVSLGAHVAGFIGAML----GGRVGRITGLDPAGPMFASVSPEERL 197

  Fly   243 DKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEF 307
            |.|||.|||::|||.|     ..|:....||:||:.|||.|.|||         .||:|.....|
Zfish   198 DPTDAQFVDVLHTDMN-----SFGLRGTHGHIDFYANGGLDQPGC---------PKTIFSGKSYF 248

  Fly   308 LGCNHIRSQQYFTESIGSQCPFLGITCDSFESFKDTKCTSCE--EPGHTCLRMGYHSQEDYQEQV 370
            : |:|.||...:..|:...|...|..|.|:..|...:|..||  :|. :|..:||...:.....:
Zfish   249 V-CDHQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQCLQCETFKPA-SCPVLGYDLSQWRDTLL 311

  Fly   371 DLGQLQQGDSPGVFYLWTGDSKPFCRLHYRITVRVSGHDESTLHGGEVGILSIQLHDALVKKAGK 435
            .|||.:.       |..|....|:.:..||:.: |:.:...     ..|::.::||:      ||
Zfish   312 RLGQTRA-------YFSTTAELPYSKTSYRVDL-VTWNQFL-----RWGVVILRLHN------GK 357

  Fly   436 NERAA---TEMMKFSQ------KAMYFEPGYEYK----ALVAGRNLREPEYATVNWEYPTNILNP 487
            |...|   .::|:|.|      .|.:.|..|..:    .:|.| |:..|.|.          :..
Zfish   358 NVTEAHIDNKLMRFEQYTSTRLLAQFDEDLYPIQKISLRIVTG-NVIGPRYK----------IRL 411

  Fly   488 LTWRILSAPRIYLEY-----ILIEAMESSDLYLKLCPQH 521
            |..||....:.|...     |::|  |::::..|..|.|
Zfish   412 LRIRISPLEKPYRSLMCRYDIIVE--ENAEVSFKPLPCH 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5966NP_572286.1 Lipase 46..394 CDD:278576 98/282 (35%)
Pancreat_lipase_like 76..390 CDD:238363 98/278 (35%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 98/282 (35%)
Pancreat_lipase_like 40..324 CDD:238363 98/278 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D247005at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6371
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.