DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss5

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:267 Identity:93/267 - (34%)
Similarity:127/267 - (47%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPRFNADPGRIINGTEASLGA---TRHQVGIRKALNDG-------YFFGTGHLCGGSLIRPGWVL 90
            :|..|...|||::...:..||   ....|| .:|:..|       ...|:.|.||.|::.|.||:
Mouse   191 KPSANCPSGRIVSLKCSECGARPLASRIVG-GQAVASGRWPWQASVMLGSRHTCGASVLAPHWVV 254

  Fly    91 TAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLM 155
            |||||     :|.........:.|..| |..:........|:.|:|:....:....:|.|:|||.
Mouse   255 TAAHC-----MYSFRLSRLSSWRVHAG-LVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQ 313

  Fly   156 LNGTVPTGHPTIRPIAL--NRFAIPEGVVCQVTGWGNTEDGYV--SDILMTVDVPMISEEHCIND 216
            |. |......|:..:.|  .....|.|..|.|:|||:|:..:.  ||.|....||::|...|.:.
Mouse   314 LR-TPINFSDTVGAVCLPAKEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTYLCNSS 377

  Fly   217 SDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQS----ELAGVVSWGIQCALPRLPGVYTEV 277
            ......:...|:|||||: |..|||.|||||||||.|    .|.||||||..||.|..||||.:|
Mouse   378 CMYSGALTHRMLCAGYLD-GRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKV 441

  Fly   278 SYYYDWI 284
            :.:.|||
Mouse   442 AEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 88/256 (34%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 7/21 (33%)
Tryp_SPc 217..448 CDD:214473 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.