DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and prss60.1

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:303 Identity:103/303 - (33%)
Similarity:141/303 - (46%) Gaps:61/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFG 74
            |:|.|:....|     :.:.|:...:.|..|    ||:.|..|..|:...||.:...:     :|
Zfish     7 VSLALLLCVQG-----SHSQLNVCGLAPLNN----RIVGGVNAFDGSWPWQVSLHSPI-----YG 57

  Fly    75 TGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK---EEFIVVMG-------NLDRYNRTNTLT 129
             ||.||||||...||||||||           :|:   ...:|.:|       |....|||.:: 
Zfish    58 -GHFCGGSLINSEWVLTAAHC-----------LPRITTSSLLVFLGKTTQQGVNTYEINRTVSV- 109

  Fly   130 FTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIAL--NRFAIPEGVVCQVTGWGNTE 192
            .|:......|      |.:.|||||.|:..| |....|||:.|  .....|.|....:|||||.:
Zfish   110 ITVHPSYNNL------TNENDIALLHLSSAV-TFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQ 167

  Fly   193 DGY---VSDILMTVDVPMISEEHCINDSDLGH-LIQPGMICAGYLEVGEKDACAGDSGGPLVCQS 253
            .|.   ...||....:|::..:.|  ::.||. .:...|||||.|: |.:|.|.||||||:|.:.
Zfish   168 LGVNLPAPGILQETMIPVVPNDQC--NALLGSGSVTNNMICAGLLQ-GGRDTCQGDSGGPMVSKQ 229

  Fly   254 EL----AGVVSWGIQCALPRLPGVYTEVSYYYDW----ILQNM 288
            .|    :|:.|||..||.|..|||||.||.|..|    |:||:
Zfish   230 CLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIVQNL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 93/262 (35%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 92/258 (36%)
Tryp_SPc 34..267 CDD:238113 92/260 (35%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.