DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Prss36

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:279 Identity:96/279 - (34%)
Similarity:136/279 - (48%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||:.|::|..|....||.:.:        |.||:||||||.|.|||:||||||.    :||..|.
Mouse    47 RIVGGSDAHPGTWPWQVSLHQ--------GGGHICGGSLIAPSWVLSAAHCFVT----NGTLEPA 99

  Fly   110 EEFIVVM------GNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIR 168
            :|..|::      |.|:..:..:..|..|.      |.:.......|:|||.|......| |::|
Mouse   100 DELSVLLGVHSQDGPLEGAHMRSVATILIP------DNYSTVELGADLALLRLASPAKLG-PSVR 157

  Fly   169 PIALNR----FAIPEGVVCQVTGWGNTEDGY---VSDILMTVDVPMISEEHC------INDSDLG 220
            |:.|.|    ||  .|..|..||||:.::..   :..:|..|::.::.|..|      ....:|.
Mouse   158 PVCLPRASHLFA--HGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLT 220

  Fly   221 HLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYY 281
            ..:.|||:|||| ..|.:|.|.|||||||||:..    |||:.|:|..|.....|||:|.|:.|.
Mouse   221 FQLLPGMLCAGY-PAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYE 284

  Fly   282 DWILQNMGENGEGSGEESG 300
            .||.:::      .|.|.|
Mouse   285 SWIREHV------MGSEPG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 91/261 (35%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 92/263 (35%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.