DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and XB5723326

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:256 Identity:68/256 - (26%)
Similarity:117/256 - (45%) Gaps:58/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRT 125
            |.|:|.:..||    .|:|.|:::...|::||||||.|....|    |.....|::|        
 Frog    31 VSIQKKVELGY----KHICAGTILNNEWIITAAHCFKDWKEGD----PTTPLRVLLG-------- 79

  Fly   126 NTLTFTIEE-----------RIMQLDKFDLSTYDKDIALLMLNGTVP-TGHPTIRPIALNRFAIP 178
               ||.:.|           ::::.|::|..|...||||:.|:..|. :.|       :.:...|
 Frog    80 ---TFYLSEIGLRTQSRGVKQLIKHDQYDPITESNDIALIQLDKQVEFSDH-------IQQACFP 134

  Fly   179 EG-------VVCQVTGWGNTEDGYV---SDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYL 233
            :.       :.|.:.||| .:..::   |..|....|..|..:|| |....| ::....:|||:.
 Frog   135 KESADLKDLIDCSIAGWG-AQGKHLDEPSQFLQEAQVERIDTKHC-NKWYQG-ILGENHLCAGHR 196

  Fly   234 EVGEKDACAGDSGGPLVCQSE------LAGVVSWGIQCALPRLPGVYTEVSYYYDWILQNM 288
            : |.:..|.||.|.||:|:::      :.|:::||..|...|.||||:.:..:..||::.:
 Frog   197 K-GPEKTCNGDRGSPLMCRTKKNNVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWIVEKV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 66/250 (26%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.