DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss6

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_082178.2 Gene:Tmprss6 / 71753 MGIID:1919003 Length:811 Species:Mus musculus


Alignment Length:257 Identity:95/257 - (36%)
Similarity:136/257 - (52%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||:.||.:|.|....|..::        ....|:|||:||...||:||||||.:    |....||
Mouse   576 RIVGGTVSSEGEWPWQASLQ--------IRGRHICGGALIADRWVITAAHCFQE----DSMASPK 628

  Fly   110 EEFIVVMGNLDRYNR-TNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHP-----TIR 168
             .:.|.:|.:.:.:| ...::|.: .|:......:..::|.|:|||.|:      ||     |:|
Mouse   629 -LWTVFLGKMRQNSRWPGEVSFKV-SRLFLHPYHEEDSHDYDVALLQLD------HPVVYSATVR 685

  Fly   169 PIAL---NRFAIPEGVVCQVTGWG-NTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMIC 229
            |:.|   :.|..| |..|.:|||| ..|.|.||:.|..|||.::.::.|  .....:.:.|.|:|
Mouse   686 PVCLPARSHFFEP-GQHCWITGWGAQREGGPVSNTLQKVDVQLVPQDLC--SEAYRYQVSPRMLC 747

  Fly   230 AGYLEVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVYTEVSYYYDWILQ 286
            |||.: |:||||.|||||||||:..     |||:||||:.|..|...||||.|:...:||.|
Mouse   748 AGYRK-GKKDACQGDSGGPLVCREPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVINWIQQ 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 92/253 (36%)
Tmprss6NP_082178.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 92/253 (36%)
Tryp_SPc 577..809 CDD:238113 94/256 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.