DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:263 Identity:85/263 - (32%)
Similarity:124/263 - (47%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQI-------IY 102
            ||:.|..|..||...||.:.        ....|:||||:|.|.|::|||||....:       .:
Human   292 RIVGGESALPGAWPWQVSLH--------VQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAF 348

  Fly   103 DGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTI 167
            .|  :.::.|:.......            .|:::....:|..|.:.||||:.|...: |.:..:
Human   349 AG--ILRQSFMFYGAGYQ------------VEKVISHPNYDSKTKNNDIALMKLQKPL-TFNDLV 398

  Fly   168 RPIAL---NRFAIPEGVVCQVTGWGNTED-GYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMI 228
            :|:.|   .....|| .:|.::|||.||: |..|::|....|.:|..:.|.:.....:||.|.||
Human   399 KPVCLPNPGMMLQPE-QLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMI 462

  Fly   229 CAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYDWILQNMG 289
            |||:|: |..|:|.||||||||....    |.|..|||..||....||||..|..:.|||.:.|.
Human   463 CAGFLQ-GNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMR 526

  Fly   290 ENG 292
            .:|
Human   527 ADG 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 81/253 (32%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133
Tryp_SPc 292..521 CDD:214473 81/253 (32%)
Tryp_SPc 293..524 CDD:238113 82/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.