DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Prss56

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:301 Identity:102/301 - (33%)
Similarity:132/301 - (43%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWV 89
            |||.|              |||:.|:.|..||....|.::        .|...||||.|:...||
Mouse   103 TTRAH--------------GRIVGGSTAPSGAWPWLVRLQ--------LGGLPLCGGVLVAASWV 145

  Fly    90 LTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTI-----------EE----RIMQL 139
            |||||||.                         ..:|.|.:|:           ||    ||:..
Mouse   146 LTAAHCFA-------------------------GASNELLWTVMLAEGPQGEQAEEVQVNRILPH 185

  Fly   140 DKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFA--IPEGVVCQVTGWGNT-EDGYVSDILM 201
            .|||..|:..|:||:.|...|....|. |||.|.:.:  .|.|..|.:.|||.. |||..|:.:.
Mouse   186 PKFDPQTFHNDLALVQLWTPVSPEGPA-RPICLPQGSREPPAGTPCAIAGWGALFEDGPESEAVR 249

  Fly   202 TVDVPMISEEHCINDSDLGHLIQPG-MICAGYLEVGEKDACAGDSGGPLVC-------QSELAGV 258
            ...||::|.:.|  ...||..::|. |:||||| .|..|:|.|||||||.|       :..|.||
Mouse   250 EARVPLLSADTC--QKVLGPGLRPSTMLCAGYL-AGGIDSCQGDSGGPLTCSEPGPRPREVLFGV 311

  Fly   259 VSWGIQCALPRLPGVYTEVSYYYDWILQNMGENGEGSGEES 299
            .|||..|..|..|||||.|:.:.||:.:.|.. |..:.|.|
Mouse   312 TSWGDGCGEPGKPGVYTRVTVFKDWLQEQMSA-GPSTREPS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 92/264 (35%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 91/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.