DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Klk5

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:290 Identity:85/290 - (29%)
Similarity:129/290 - (44%) Gaps:50/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSGLRGATTRTHL--DTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCG 80
            |||...:.|...|  |:|:.....:....||:||::....|...|..:....|..|       ||
Mouse    38 PSGTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLY-------CG 95

  Fly    81 GSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK---- 141
            ..||.|.|:||||||            .|..|.:.:|     :.:.:..:...:::.|..|    
Mouse    96 AVLISPQWLLTAAHC------------RKPVFRIRLG-----HHSMSPVYESGQQMFQGIKSIPH 143

  Fly   142 --FDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTEDGY--VSDILMT 202
              :....:..|:.|:.:|..:...| :::|:.:......||..|.|:|||.|...:  ...:|..
Mouse   144 PGYSHPGHSNDLMLIKMNRKIRDSH-SVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQC 207

  Fly   203 VDVPMISEEHCINDSDLGHLIQPG-----MICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWG 262
            :::.::|||.|.|.       .||     |.|||..|  .:|:|.||||||:||..:|.|:||||
Mouse   208 LNITVLSEERCKNS-------YPGQIDKTMFCAGDEE--GRDSCQGDSGGPVVCNGKLQGLVSWG 263

  Fly   263 -IQCALPRLPGVYTEVSYYYDWILQNMGEN 291
             ..||....|||||.:..:..||...|..|
Mouse   264 DFPCAQRNRPGVYTNLCEFVKWIKDTMNSN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 74/252 (29%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.