DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and zgc:123217

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:320 Identity:94/320 - (29%)
Similarity:137/320 - (42%) Gaps:77/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALLLIFLPSGLRGATTRTHLDTKA-------IRPRFNADPGRIINGTEASLGATRHQVGIRKAL 67
            :.||::.|.|.:...:|:   |:.|       :.| .|.   ||:.||:|..|:...||.|.   
Zfish     1 MGLLVLLLSSAVIMLSTQ---DSNAQTTYECGVAP-LNT---RIVGGTDAPAGSWPWQVSIH--- 55

  Fly    68 NDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTI 132
                 :...|:|||:||...||:|||||.::..|...|..           |.|..::.::....
Zfish    56 -----YNNRHICGGTLIHSQWVMTAAHCIINTNINVWTLY-----------LGRQTQSTSVANPN 104

  Fly   133 E-----ERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPT-----IRPIAL--NRFAIPEGVVCQV 185
            |     :.|:....|:.|..:.||:|:.|:      .|.     ||||.|  |......|..|..
Zfish   105 EVKVGIQSIIDHPSFNNSLLNNDISLMKLS------QPVNFSLYIRPICLAANNSIFYNGTSCWA 163

  Fly   186 TGWGNTEDGY---VSDILMTVDVPMISEEHC------INDSDLGHLIQPGMICAGYLEVGEKDAC 241
            |||||.....   ....|..|.:|:::...|      :|::    .|.|.|||||   ...|..|
Zfish   164 TGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESVNNA----TITPQMICAG---KANKGTC 221

  Fly   242 AGDSGGPLVCQSE----LAGVVSWGIQ--CALPRLPGVYTEVSYYYDWILQNMGENGEGS 295
            .||||||..|:..    .||:.|:|..  ||:...|.||:.||.:..||..|:    :||
Zfish   222 QGDSGGPFQCKQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNV----QGS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 80/265 (30%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 80/265 (30%)
Tryp_SPc 37..273 CDD:238113 81/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.