DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG34290

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:269 Identity:77/269 - (28%)
Similarity:115/269 - (42%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GRIINGTEASLGATRHQVGIRKALNDGYFFGTG--HLCGGSLIRPGWVLTAAHC-FVDQIIYDGT 105
            |||::...:|.......|.::..:......|..  |.||||||...|:|:|||| :...|.|...
  Fly    37 GRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIHYIAA 101

  Fly   106 FVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLML---------NGTVP 161
            |:..|. |..:|.|..|...:          ::...|..|.:..|||||.:         ||...
  Fly   102 FIGYEN-IENIGQLQPYGLES----------VEYIYFQPSNFRNDIALLYMKRRYWSDFGNGLQY 155

  Fly   162 TGHPTIRPIALNRFAIPEGV------VCQVTGWGNTED-GYVSDILMTVDVPMISEEHCINDSDL 219
            ...|            |.|:      .|::.|:|.|.. |.....|...:|.:|..:.|  ...:
  Fly   156 AQLP------------PHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKC--RDII 206

  Fly   220 GHLIQP----GMICAGYLEVG-EKDACAGDSGGPLVC----QSELAGVVSWGIQCALPRLPGVYT 275
            ||:..|    ..:||    :| .:|:|.|||||||:|    :..:.|:||.|:.|.:|.:|.:||
  Fly   207 GHIWAPQNGANTVCA----LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYT 267

  Fly   276 EVSYYYDWI 284
            ....||||:
  Fly   268 VTRPYYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 75/266 (28%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 77/269 (29%)
Tryp_SPc 34..276 CDD:214473 76/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.