DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:94 Identity:41/94 - (43%)
Similarity:54/94 - (57%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQS----ELAGVVSWGIQC 265
            ||::....|.|  .||..|...|:|||.|: |.||.|.||||||:|.|.    ..:|::|.|..|
Zfish    21 VPVVINSDCNN--LLGATITDNMMCAGLLQ-GGKDTCQGDSGGPMVSQQCSVWVQSGIISKGHDC 82

  Fly   266 ALPRLPGVYTEVSYYYDWILQNMGENGEG 294
            ..|..|||||.||.|.:||:.::.:|..|
Zfish    83 GQPYEPGVYTRVSQYQNWIMSSINQNLPG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 37/82 (45%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 39/84 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.