DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:251 Identity:90/251 - (35%)
Similarity:124/251 - (49%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            |::...|||:.:...||.|:        :...|:||||::.|.|||||||||..   :...|..|
Human   204 RVVGVEEASVDSWPWQVSIQ--------YDKQHVCGGSILDPHWVLTAAHCFRK---HTDVFNWK 257

  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNR 174
                 |....|:.....:|...   :|:.::...:...|.||||:.|...: |...|:|||.|..
Human   258 -----VRAGSDKLGSFPSLAVA---KIIIIEFNPMYPKDNDIALMKLQFPL-TFSGTVRPICLPF 313

  Fly   175 F------AIPEGVVCQVTGWGNTED--GYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAG 231
            |      |.|..::    |||.|:.  |.:||||:...|.:|....|..|......:...|:|||
Human   314 FDEELTPATPLWII----GWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAG 374

  Fly   232 YLEVGEKDACAGDSGGPLVCQSE---LAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            ..| |..|.|.|||||||:.||:   :.|:||||..|..|..|||||:||.|.:||
Human   375 IPE-GGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 88/249 (35%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335
Tryp_SPc 204..429 CDD:214473 88/249 (35%)
Tryp_SPc 205..432 CDD:238113 89/250 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.