DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and KLK7

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:294 Identity:93/294 - (31%)
Similarity:130/294 - (44%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGY 71
            ||.:.:||:.|.....|.               .|...:||:|...:.|:...||.:        
Human     6 LLPLQILLLSLALETAGE---------------EAQGDKIIDGAPCARGSHPWQVAL-------- 47

  Fly    72 FFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERI 136
            ..|....|||.|:...||||||||.::            |:.|.:|       ::||.....:||
Human    48 LSGNQLHCGGVLVNERWVLTAAHCKMN------------EYTVHLG-------SDTLGDRRAQRI 93

  Fly   137 MQLDKF-----DLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNT---ED 193
            .....|     ...|:..|:.|:.||...... ..::.:.|.....|.|..|.|:|||.|   :.
Human    94 KASKSFRHPGYSTQTHVNDLMLVKLNSQARLS-SMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDV 157

  Fly   194 GYVSDILMTVDVPMISEEHC---INDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSEL 255
            .:.|| ||.|||.:||.:.|   ..|     |::..|:||| :...:|:||.|||||||||:..|
Human   158 TFPSD-LMCVDVKLISPQDCTKVYKD-----LLENSMLCAG-IPDSKKNACNGDSGGPLVCRGTL 215

  Fly   256 AGVVSWG-IQCALPRLPGVYTEVSYYYDWILQNM 288
            .|:|||| ..|..|..|||||:|..:..||...|
Human   216 QGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 83/250 (33%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 83/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.