DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Mcpt10

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_058842.2 Gene:Mcpt10 / 54269 RGDID:3063 Length:248 Species:Rattus norvegicus


Alignment Length:275 Identity:84/275 - (30%)
Similarity:117/275 - (42%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTG--HLCGGSLIRPGWVLTAAHCF 96
            ||.| .|.:.|.||.|||:...:..:...:.      :::|..  |.|||.|:....|:|||||.
  Rat    10 AILP-VNTEGGEIIWGTESKPHSRPYMASLM------FYYGNSYRHYCGGFLVAKDIVMTAAHCN 67

  Fly    97 VDQI-IYDGTF-VPKEEFIVVMG--------NLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDI 151
            ...| :..|.. :.|:|...|:.        |.||::|.|.:.....||..|             
  Rat    68 GSNIKVTLGAHNIKKQEKTQVIAVVKAKPHENYDRHSRFNDIMLLKLERKAQ------------- 119

  Fly   152 ALLMLNGTVPTGHPTIRPIALNRFA--IPEGVVCQVTGWGNTEDGYVSDILMTVDVPMISEEHC- 213
                |||.|.|       |||.|..  :..|.||.|.|||...:..:|:.|..|::.:...:.| 
  Rat   120 ----LNGAVKT-------IALPRSQDWVKPGQVCTVAGWGCLANCSLSNTLQEVNLEVQEGQKCE 173

  Fly   214 -----INDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQCALPRLPGV 273
                 .|||     ||   :|.|....| |....||||||.||.....|:||:.: |. ..||.|
  Rat   174 DMSRNYNDS-----IQ---LCVGNPSEG-KATGKGDSGGPFVCDGVAQGIVSYRL-CT-GTLPRV 227

  Fly   274 YTEVSYYYDWILQNM 288
            :|.:|.:..||.:.|
  Rat   228 FTRISSFIPWIQKTM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 76/258 (29%)
Mcpt10NP_058842.2 Tryp_SPc 21..241 CDD:238113 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.