DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Cfd

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:259 Identity:84/259 - (32%)
Similarity:122/259 - (47%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQI 100
            :||     |||:.|.||...|..:...::  :|     || |:|||:|:...|||:||||.    
  Rat    21 QPR-----GRILGGQEAMAHARPYMASVQ--VN-----GT-HVCGGTLVDEQWVLSAAHCM---- 68

  Fly   101 IYDGTFVPKEEFIVV------MGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGT 159
              ||  |.|:|.:.|      :.:.:.|..    .:.::..::.......|..| |:.|..|:..
  Rat    69 --DG--VTKDEVVQVLLGAHSLSSPEPYKH----LYDVQSVVLHPGSRPDSVED-DLMLFKLSHN 124

  Fly   160 VPTGHPTIRPIALNR--FAIPEGVVCQVTGWG-NTEDGYVSDILMTVDVPMISEEHCINDSDLGH 221
            ...| |.:||:.|.|  ..:..|.:|.|.||| .|..|...|:|..:.|.::....|...:....
  Rat   125 ASLG-PHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDG 188

  Fly   222 LIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGVVSWGIQ-CALPRLPGVYTEVSYYYDWI 284
            .|...|:||   |...:|.|.|||||||||...:..||:||.: |...|.|||:|.|:.|..||
  Rat   189 AITKNMMCA---ESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 79/248 (32%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.