DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and prss60.2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:260 Identity:93/260 - (35%)
Similarity:126/260 - (48%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||:.|..|..|:...||.::...     :| ||.||||||...||||||||...        |.:
Zfish    33 RIVGGVNAPEGSWPWQVSLQSPR-----YG-GHFCGGSLISSEWVLTAAHCLPG--------VSE 83

  Fly   110 EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIAL-- 172
            ...:|.:|...:.......|.....:|:....::.:|.|.|||||.|:..| |.:..|||:.|  
Zfish    84 SSLVVYLGRRTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAV-TFNDYIRPVCLAA 147

  Fly   173 NRFAIPEGVVCQVTGWGNTEDGY---VSDILMTVDVPMISEEHCINDSDLGH-LIQPGMICAGYL 233
            .......|....:||||:.:.|.   ...||....:|:::.:.|  ::.||. .:...||||| |
Zfish   148 QNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRC--NAQLGSGTVTNNMICAG-L 209

  Fly   234 EVGEKDACAGDSGGPLV---CQSEL-AGVVSWGIQCALPRLPGVYTEVSYYYDWILQNMGENGEG 294
            ..|.||.|.||||||:|   |...: ||:.|||..||.|..|||||.||.|..||...:.:|..|
Zfish   210 AKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISQNQPG 274

  Fly   295  294
            Zfish   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 89/248 (36%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 89/248 (36%)
Tryp_SPc 34..267 CDD:238113 90/250 (36%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.