DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss2

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:266 Identity:91/266 - (34%)
Similarity:125/266 - (46%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQII---YDGTF 106
            ||:.|..||.|....||.:       :..|. |:||||:|.|.|::|||||..:.:.   |...|
Mouse   253 RIVGGLNASPGDWPWQVSL-------HVQGV-HVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAF 309

  Fly   107 VPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIA 171
            ..     ::..:|..|...:.:     |:::....:|..|.:.||||:.|.          .|:|
Mouse   310 AG-----ILRQSLMFYGSRHQV-----EKVISHPNYDSKTKNNDIALMKLQ----------TPLA 354

  Fly   172 LNRFAIP-----EGVV------CQVTGWGNT-EDGYVSDILMTVDVPMISEEHCINDSDLGHLIQ 224
            .|....|     .|::      |.::|||.| |.|..||:|....||:|....|.:.....:||.
Mouse   355 FNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLIT 419

  Fly   225 PGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYDWIL 285
            |.|||||:|: |..|:|.||||||||....    |.|..|||..||....||||..|:.:.|||.
Mouse   420 PAMICAGFLQ-GSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIY 483

  Fly   286 QNMGEN 291
            |.|..|
Mouse   484 QQMRAN 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/257 (33%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897
Tryp_SPc 254..485 CDD:238113 87/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.