DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Prss53

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:332 Identity:87/332 - (26%)
Similarity:130/332 - (39%) Gaps:76/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEE---RIMQ 138
            |:|.|||:...|||||||||......:     ...:.||:|:|    :...|:...||   ..:|
  Rat    60 HICSGSLVADTWVLTAAHCFEKMATAE-----LSSWSVVLGSL----KQEGLSPGAEEVGVAALQ 115

  Fly   139 LDK-FDLSTYDKDIALLMLNGTVPTGHPTI-RPIALNRFAIPEGVVCQVTGWG-NTEDGY----- 195
            |.| ::..:...|:|||.|  |.|..|.|: .|...:.|  |.|..|..|||. ||.||.     
  Rat   116 LPKAYNHYSQGSDLALLQL--THPIVHTTLCLPQPTHHF--PFGASCWATGWDQNTSDGKYCPRH 176

  Fly   196 --------------------------------VSDILMTVDVPMISEEHC------INDSDLGHL 222
                                            ||..|..:.:.:||...|      ::...|.:.
  Rat   177 KSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANP 241

  Fly   223 IQPGMICAGYLEVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVYTEVSYYYD 282
            .:.||:|.| .:.|.:..|.||||||::|:..     ..|::|:...||....|.:.|:::.:..
  Rat   242 ARSGMLCGG-AQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSS 305

  Fly   283 WILQNMGE-----NGEGSGEESGEGSGEGSGEGSGEGSGEGSGDDGSGD---DEDGSGDGGGAMA 339
            |:..::..     ...|..:.|.|.|....|..|..|...|:......|   ...|....|||:.
  Rat   306 WLQAHVDRAAFLVQDPGVVKMSDENSCVACGSLSSGGPQAGALSQWPWDARLKHHGKLACGGALV 370

  Fly   340 AVAGSLT 346
            :....||
  Rat   371 SEVVVLT 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 71/260 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 72/263 (27%)
Tryp_SPc 341..561 CDD:238113 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.