DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Prss36

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:282 Identity:98/282 - (34%)
Similarity:140/282 - (49%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||:.|::|..|....||.:.        .|.||:||||||.|.|||:||||||.    :||..|.
  Rat    58 RIVGGSDAHPGTWPWQVSLH--------HGGGHICGGSLIAPSWVLSAAHCFVT----NGTLEPA 110

  Fly   110 EEFIVVM------GNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIR 168
            :|:.|::      |.|:..:..:..|      |:..|.:.......|:|||.|......| |:::
  Rat   111 DEWSVLLGVHSQDGPLEGAHMRSVAT------ILVPDNYSRVELGADLALLRLASPAKLG-PSVK 168

  Fly   169 PIALNR----FAIPEGVVCQVTGWGNTEDGYVSD------ILMTVDVPMISEEHC------INDS 217
            |:.|.|    ||  .|..|..||||:.::   ||      :|..|::.::.|..|      ....
  Rat   169 PVCLPRASHLFA--HGTACWATGWGDVQE---SDPLPVPWVLQEVELKLLGETACQCLYSRPGPF 228

  Fly   218 DLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVS 278
            :|...:.|||:||||.| |.:|.|.|||||||||:..    |||:.|:|..|.....|||:|.|:
  Rat   229 NLTLQLLPGMLCAGYPE-GRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVA 292

  Fly   279 YYYDWILQNMGENGEGSGEESG 300
            :|..||.:::      .|.|.|
  Rat   293 HYESWIREHV------MGSEPG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 93/264 (35%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 94/266 (35%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.