DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and prss27

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:283 Identity:101/283 - (35%)
Similarity:135/283 - (47%) Gaps:52/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 THLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTA 92
            |.:.|...:|.|:   .||:.|..|..|....||.|        .:...|:|||||:...||::|
 Frog   405 TAISTGCGQPAFS---DRIVGGNNAVFGEWPWQVSI--------VYQNSHICGGSLVSSNWVVSA 458

  Fly    93 AHCFVDQIIYDGTFVPK----EEFIVVMGNLDRYNRTNTLTFTIEERIMQLDKFDLSTYDKDIAL 153
            ||||           |:    |...|::|.....|.|:.......:|::....:.......|||:
 Frog   459 AHCF-----------PRSYKIENMQVLLGCFALMNLTSDAVIIRVKRVITYPLYTGEGSSGDIAM 512

  Fly   154 LMLNGTVPTGHPTIRPIA--LNRFAIPEGVVCQVTGWGNTEDGYVSDI-------LMTVDVPMIS 209
            :.:...| |....|.||.  |.....|.|.:|.||||||.:    ||:       |..|:||:::
 Frog   513 VEMESPV-TYSSYILPICIPLTNEDFPSGKMCWVTGWGNIQ----SDVSLSPPYPLQEVEVPLVN 572

  Fly   210 EEHCIN----DSDLG---HLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGI 263
            ...|..    :|||.   .|:...||||||.| |:||||.|||||||.|:|.    |.|:||||.
 Frog   573 ASSCDTMYHYNSDLNPATQLVHDDMICAGYPE-GQKDACQGDSGGPLACKSGNYWFLTGIVSWGD 636

  Fly   264 QCALPRLPGVYTEVSYYYDWILQ 286
            .||.|..|||||:||.:..||.|
 Frog   637 GCAQPNRPGVYTKVSSFSSWINQ 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 94/262 (36%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 95/263 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.