DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and st14

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_012821897.2 Gene:st14 / 448647 XenbaseID:XB-GENE-1008784 Length:845 Species:Xenopus tropicalis


Alignment Length:258 Identity:89/258 - (34%)
Similarity:126/258 - (48%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVD--QIIYDGTFV 107
            ||:.|..|..|....||.:       :..|..|.||.||:.|..:::|||||.|  .:.|....:
 Frog   604 RIVGGVNADTGEFPWQVSL-------HVKGNKHTCGASLVSPTMLISAAHCFQDDQSMRYSDASL 661

  Fly   108 PKEEFIVVMGNLD--RYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPT-IRP 169
                :...:|..|  :.|..:.:...| :|||....|:.:|||.||::|.|.  .|..:.. |:|
 Frog   662 ----WTAYLGLHDQAQLNSKDVVERKI-KRIMAHIGFNDNTYDNDISVLELE--KPVDYTDFIQP 719

  Fly   170 IAL--NRFAIPEGVVCQVTGWGN-TEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAG 231
            |.:  :....|.|....|||||. .|.|..:.||...::.:|::..|  :..|...:.|.|:|||
 Frog   720 ICIPESTHDFPVGKPIWVTGWGALKEGGGAAVILQKAEIRIINQTEC--NKLLDGQLTPRMLCAG 782

  Fly   232 YLEVGEKDACAGDSGGPLVC-----QSELAGVVSWGIQCALPRLPGVYTEVSYYYDWILQNMG 289
            ::. |..|||.|||||||..     :..|||:||||..||....|||||.|:...|||....|
 Frog   783 FVS-GGIDACQGDSGGPLSSVELNNKVYLAGIVSWGEGCARRNKPGVYTRVAMMRDWIRDKTG 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 86/251 (34%)
st14XP_012821897.2 SEA 76..167 CDD:396113
CUB 216..320 CDD:238001
CUB 328..432 CDD:238001
LDLa 442..474 CDD:238060
LDLa 476..511 CDD:238060
LDLa 513..547 CDD:238060
LDLa 554..587 CDD:197566
Tryp_SPc 604..839 CDD:214473 86/251 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.