DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and prss36

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:263 Identity:100/263 - (38%)
Similarity:137/263 - (52%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109
            ||:.||:|..||...||.:|        :...|:||||:|...|:|||||||      :.:..| 
 Frog   384 RIVGGTDAREGAWPWQVSLR--------YRGSHICGGSVIGTQWILTAAHCF------ENSQFP- 433

  Fly   110 EEFIVVMGNLDRYNRT--NTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGH-----PTI 167
            .::.|.:|.. |..:|  |.:|:|: :||:...:||.||...||||:.|  |.|..:     |..
 Frog   434 SDYEVRLGTY-RLAQTSPNEITYTV-DRIIVNSQFDSSTLFGDIALIRL--TSPITYTKYILPVC 494

  Fly   168 RPIALNRFAIPEGVVCQVTGWGNTEDGYVS----DILMTVDVPMISEEHCIN----DSDL---GH 221
            .|...|.|.  :|:.|.||||| |...||:    ..|..|..|:|:...|..    ||.:   ..
 Frog   495 LPSTSNSFT--DGMECWVTGWG-TISLYVNLPYPKTLQEVMTPLINRTRCDQMYHIDSPVSASSE 556

  Fly   222 LIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYD 282
            :|....||:|| ..|.||:|.|||||||||:.:    ..|:||||..||:.:.|||||.|..||.
 Frog   557 IIPSDQICSGY-SAGGKDSCKGDSGGPLVCKLQGIWYQIGIVSWGEGCAIAKRPGVYTLVPAYYS 620

  Fly   283 WIL 285
            |::
 Frog   621 WVI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 99/260 (38%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113
Tryp_SPc 385..622 CDD:238113 98/259 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.