DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and KLK12

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:296 Identity:91/296 - (30%)
Similarity:123/296 - (41%) Gaps:90/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYF 72
            |::.|||..|  ||..|.|                 .:|.||||....:...|||:        |
Human     3 LSIFLLLCVL--GLSQAAT-----------------PKIFNGTECGRNSQPWQVGL--------F 40

  Fly    73 FGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIM 137
            .||...|||.||...||||||||       .|:     .:.|.:|               |..:.
Human    41 EGTSLRCGGVLIDHRWVLTAAHC-------SGS-----RYWVRLG---------------EHSLS 78

  Fly   138 QLD--------KFDL---------STYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQV 185
            |||        .|.:         ::::.|:.||.|...|.. ..:::|:.|.......|..|.|
Human    79 QLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRV-TSSVQPLPLPNDCATAGTECHV 142

  Fly   186 TGWG--NTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPG-----MICAGYLEVGEKDACAG 243
            :|||  |.......|:|..:::.::|...|       |.:.||     |:|||  .|..:|||.|
Human   143 SGWGITNHPRNPFPDLLQCLNLSIVSHATC-------HGVYPGRITSNMVCAG--GVPGQDACQG 198

  Fly   244 DSGGPLVCQSELAGVVSWGI--QCALPRLPGVYTEV 277
            ||||||||...|.|:||||.  .|....:|||||.:
Human   199 DSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 82/259 (32%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 82/259 (32%)
Tryp_SPc 22..236 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.