DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG5909

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:241 Identity:70/241 - (29%)
Similarity:93/241 - (38%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNR--------TNTLTFTIEER 135
            ||||||....:||||||.:||         .|...|.:|..|..:.        ||.:.....|.
  Fly   159 CGGSLISERHILTAAHCIIDQ---------PEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEE 214

  Fly   136 --IMQLDKFDLSTYDK---DIALLMLNGTV-PTGHPTIRPIALNRFAIPEGVVCQ---------V 185
              |.|:.......:.|   |:|::.|:..| ...|  |:|:.|     |.....|         |
  Fly   215 YGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSH--IKPVCL-----PIDQKSQELDFDQSFFV 272

  Fly   186 TGWGNTEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLV 250
            .|||.||...|:..|....:...|...|....:.|. :....|||  ...|.|..|.||||||:.
  Fly   273 AGWGGTEKETVATKLQQALITRKSLNECRQYYNKGE-VSDNHICA--TGTGIKHTCQGDSGGPVF 334

  Fly   251 CQSELA--------GVVSWGIQCALPRLPGVYTEVSYYYDWILQNM 288
            .:....        ||||:|.:......|||:..|.....||.||:
  Fly   335 FKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWITQNL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 66/235 (28%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 66/235 (28%)
Tryp_SPc 132..379 CDD:238113 68/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.