DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and grass

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:303 Identity:87/303 - (28%)
Similarity:127/303 - (41%) Gaps:84/303 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NADPG-----RIINGTEASLGA------TRHQVGIRKALNDGYFFGTGH-LCGGSLIRPGWVLTA 92
            |.|.|     |:.||.|..|.:      .|:|.           ||... ||||::|...::|||
  Fly   108 NFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQ-----------FGESRFLCGGAMISERYILTA 161

  Fly    93 AHCF--VDQIIYDGTFVPKEEFIVVMGNLDRYNRTNT-----------------LTFTIEERIMQ 138
            |||.  :...:|:          :.:|.    :|.:|                 :...||:.::.
  Fly   162 AHCVHGLQNDLYE----------IRLGE----HRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIH 212

  Fly   139 LDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGV--------VCQVTGWGNTEDGY 195
             :|:|......|||||.||.:||. ...|:||.|   .|.:.:        ...|||||.||:|.
  Fly   213 -EKYDARHIMHDIALLKLNRSVPF-QKHIKPICL---PITDELKEKAEQISTYFVTGWGTTENGS 272

  Fly   196 VSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELA---- 256
            .||:|:..:||:.....|  .......:....:|.|..::  :|:|.|||||||...::..    
  Fly   273 SSDVLLQANVPLQPRSAC--SQAYRRAVPLSQLCVGGGDL--QDSCKGDSGGPLQAPAQYLGEYA 333

  Fly   257 ------GVVSWG-IQCALPRLPGVYTEVSYYYDWILQNMGENG 292
                  |:||.| :.|....|||:||.|..|..||...|..||
  Fly   334 PKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMASNG 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 79/283 (28%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 80/283 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.