DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and Tmprss9

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:256 Identity:88/256 - (34%)
Similarity:134/256 - (52%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVP 108
            |||:.|.||:.|....||.:|:        ...|.||.::|...|:::|||||       ..|..
Mouse   454 GRIVGGVEAAPGEFPWQVSLRE--------NHEHFCGATIIGARWLVSAAHCF-------NEFQD 503

  Fly   109 KEEFIVVMGNLDRYNRTNTLTFTIEERIMQLDK---FDLSTYDKDIALLMLNGTVPTG---HPTI 167
            ..::....|::   :.:.:....:..|::::.|   :|..|.|.|:|:|.|...:|.|   .|..
Mouse   504 PAQWAAQAGSV---HLSGSEASAVRTRVLRIAKHPAYDADTADFDVAVLELARPLPFGRYVQPAC 565

  Fly   168 RPIALNRFAIPEGVVCQVTGWGNTEDGYV--SDILMTVDVPMISEEHCINDSDLGHLIQPGMICA 230
            .|.|.:.|  |.|..|.::|||..::.::  .::|....|.::.:..|  .|..||.:...|:||
Mouse   566 LPAATHVF--PPGKKCLISGWGYLKEDFLVKPEVLQKATVELLDQSLC--SSLYGHSLTDRMVCA 626

  Fly   231 GYLEVGEKDACAGDSGGPLVCQSE-----LAGVVSWGIQCALPRLPGVYTEVSYYYDWILQ 286
            |||: |:.|:|.|||||||||:..     |||:|||||.||..|.|||||.|:...||||:
Mouse   627 GYLD-GKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTRLRDWILE 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/251 (33%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473 84/251 (33%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.