DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6048 and CG11836

DIOPT Version :9

Sequence 1:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:267 Identity:88/267 - (32%)
Similarity:127/267 - (47%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYD 103
            |:.:..||:.|...  |..::. .:.:.:.||.|.     |||||:...:||:||||...     
  Fly    90 FSNEEIRIVGGKPT--GVNQYP-WMARIVYDGKFH-----CGGSLLTKDYVLSAAHCVKK----- 141

  Fly   104 GTFVPKEEFIVVMGNLDRYNRTNTLTFTIEERIMQL--------DKFDLSTYDKDIALLMLNGTV 160
               :.|.:..|:.|:.|:       ..|.|.:.:|.        ..||..||:.|||||.|...:
  Fly   142 ---LRKSKIRVIFGDHDQ-------EITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPI 196

  Fly   161 PTGHPTIRPIALNRFAI-PEGVVCQVTGWGNT-EDGYVSDILMTVDVPMISEEHCINDSDLGHLI 223
             :....|:||.|.|:.. |.|.:..|.|||.| |.|.:..|:..|.||::|...|.|.......|
  Fly   197 -SFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRI 260

  Fly   224 QPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEVSYYYDWI 284
            ...|:|||...:   |:|.|||||||:..:.    :.|:||||:.|.....||||:.||.:..||
  Fly   261 TSSMLCAGRPSM---DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWI 322

  Fly   285 LQNMGEN 291
            ..|: ||
  Fly   323 KSNL-EN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 82/252 (33%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.